O75077 (ADA23_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 23 Short name=ADAM 23 Alternative name(s): Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 Short name=MDC-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 832 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein. |
| Subunit structure | Can bind to LGI1 and LGI4 By similarity. Ligand for integrin alpha-V/beta-3. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole. Ref.3 |
| Developmental stage | Highly expressed in the fetal brain. |
| Domain | A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | EGF-like domain Signal Transmembrane Transmembrane helix |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW central nervous system developmentTraceable author statement. Source: ProtInc proteolysisInferred from electronic annotation. Source: InterPro |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement. Source: ProtInc |
| Molecular function | integrin binding Traceable author statement. Source: ProtInc metalloendopeptidase activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: O75077-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: O75077-2) The sequence of this isoform differs from the canonical sequence as follows: 787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE | ||||||
| Isoform Gamma (identifier: O75077-3) The sequence of this isoform differs from the canonical sequence as follows: 787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 59 | 59 | Potential | ||||||||
| Propeptide | 60 – 286 | 227 | Potential | PRO_0000029118 | |||||||
| Chain | 287 – 832 | 546 | Disintegrin and metalloproteinase domain-containing protein 23 | PRO_0000029119 | |||||||
Regions | |||||||||||
| Topological domain | 287 – 792 | 506 | Extracellular Potential | ||||||||
| Transmembrane | 793 – 813 | 21 | Helical; Potential | ||||||||
| Topological domain | 814 – 832 | 19 | Cytoplasmic Potential | ||||||||
| Domain | 299 – 496 | 198 | Peptidase M12B | ||||||||
| Domain | 502 – 588 | 87 | Disintegrin | ||||||||
| Domain | 732 – 769 | 38 | EGF-like | ||||||||
| Region | 563 – 568 | 6 | May bind the integrin receptor | ||||||||
| Compositional bias | 589 – 611 | 23 | Cys-rich | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 707 | 1 | Phosphotyrosine Ref.6 | ||||||||
| Glycosylation | 76 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 96 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 263 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 547 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 548 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 664 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 732 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 408 ↔ 491 | By similarity | |||||||||
| Disulfide bond | 450 ↔ 475 | By similarity | |||||||||
| Disulfide bond | 452 ↔ 459 | By similarity | |||||||||
| Disulfide bond | 560 ↔ 580 | By similarity | |||||||||
| Disulfide bond | 736 ↔ 751 | By similarity | |||||||||
| Disulfide bond | 745 ↔ 757 | By similarity | |||||||||
| Disulfide bond | 759 ↔ 768 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 787 – 832 | 46 | GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma. | VSP_012045 | |||||||
| Alternative sequence | 787 – 817 | 31 | GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta. | VSP_012046 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 566 | 1 | E → A: Significantly lower of adhesion-promoting activity. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain." Sagane K., Ohya Y., Hasegawa Y., Tanaka I. Biochem. J. 334:93-98(1998) [PubMed: 9693107] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). Tissue: Brain. |
| [2] | "ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alpha v beta 3 integrin through an RGD-independent mechanism." Cal S., Freije J.M.P., Lopez J.M., Takada Y., Lopez-Otin C. Mol. Biol. Cell 11:1457-1469(2000) [PubMed: 10749942] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), INTERACTION WITH INTEGRIN ALPHA-V/BETA-3, MUTAGENESIS OF GLU-566. Tissue: Brain. |
| [3] | "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains." Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S. Gene 325:171-178(2004) [PubMed: 14697522] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Brain. |
| [6] | "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry." Tao W.A., Wollscheid B., O'Brien R., Eng J.K., Li X.-J., Bodenmiller B., Watts J.D., Hood L., Aebersold R. Nat. Methods 2:591-598(2005) [PubMed: 16094384] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-707, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB009672 mRNA. Translation: BAA32351.1. AJ005580 mRNA. Translation: CAC20565.1. CH471063 Genomic DNA. Translation: EAW70386.1. BC132763 mRNA. Translation: AAI32764.1. BC132765 mRNA. Translation: AAI32766.1. |
| IPI | IPI00021903. IPI00477723. IPI00478084. |
| RefSeq | NP_003803.1. NM_003812.2. |
| UniGene | Hs.591643. |
3D structure databases | |
| ProteinModelPortal | O75077. |
| SMR | O75077. Positions 293-774. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-257697. |
| STRING | O75077. |
Protein family/group databases | |
| MEROPS | M12.979. |
PTM databases | |
| PhosphoSite | O75077. |
Proteomic databases | |
| PRIDE | O75077. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264377; ENSP00000264377; ENSG00000114948. |
| GeneID | 8745. |
| KEGG | hsa:8745. |
| UCSC | uc002vbq.1. human. |
Organism-specific databases | |
| CTD | 8745. |
| GeneCards | GC02P207272. |
| H-InvDB | HIX0002773. |
| HGNC | HGNC:202. ADAM23. |
| HPA | CAB033276. HPA012130. |
| MIM | 603710. gene. |
| neXtProt | NX_O75077. |
| PharmGKB | PA24519. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG050456. |
| OMA | SCLFQPR. |
| OrthoDB | EOG4HX50C. |
| PhylomeDB | O75077. |
Gene expression databases | |
| ArrayExpress | O75077. |
| Bgee | O75077. |
| CleanEx | HS_ADAM23. |
| Genevestigator | O75077. |
| GermOnline | ENSG00000114948. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR000742. EGF_3. IPR024079. MetalloPept_cat_dom. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. G3DSA:3.40.390.10. G3DSA:3.40.390.10. 1 hit. |
| KO | K06837. |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. SM00181. EGF. 1 hit. [Graphical view] |
| SUPFAM | SSF57552. Disintegrin. 1 hit. |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00427. DISINTEGRIN_1. False negative. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. 1 hit. PS01186. EGF_2. False negative. PS50026. EGF_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 32813. |
| SOURCE | Search... |
Entry information
| Entry name | ADA23_HUMAN | ||||||||
| Accession | Primary (citable) accession number: O75077 Secondary accession number(s): A2RU59 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with